Skip to the beginning of the images gallery

Recombinant Human Dkk-1 Protein

Grade & Purity:

≥95%(SDS-PAGE)

Expression System: HEK293
Accession #: O94907
Protein Tag: C-His
Bioactivity: Immobilized Recombinant Human Dkk-1 Protein (rp181236) at 1.0 μg/mL can bind Recombinant DKK1 Antibody (Ab099940) with the EC50 of 5.57 ng/mL.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp181236

Grouped product items
SKU	Size	Availability	Price
rp181236-10μg	10μg	≥10	$59.90
rp181236-50μg	50μg	5	$139.90
rp181236-100μg	100μg	5	$219.90
rp181236-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,599.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F cell, C-His tag, 2-266 aa

View related series

Click to view protein information: DKK1

Accession#:O94907 (4) Dkk-1 (1) DKK1 (4) Gene ID:22943 (4)

Basic Description

Product Name	Recombinant Human Dkk-1 Protein
Synonyms	dickkopf homolog 1 (Xenopus laevis) \| dickkopf related protein-1 \| Dickkopf-1 \| dickkopf-related protein 1 \| Dkk1 \| Dkk-1 \| hDkk-1 \| SKdickkopf-1 like \| dickkopf (Xenopus laevis) homolog 1
Grade	ActiBioPure™, Animal Free, Bioactive, Carrier Free
Product Description	Protein Function: Dickkopf related protein 1 (Dkk-1) is the founding member of the Dickkopf family of proteins that includes Dkk-1, -2, -3, -4, and a related protein, Soggy. Dkk proteins are secreted proteins that contain two conserved cysteine-rich domains separated by a linker region. Each domain contains ten cysteine residues. Mature human Dkk-1 is a 40 kDa glycosylated protein that shares 86%, 87%, 90%, and 91% aa sequence identity with mouse, rat, rabbit, and bovine Dkk-1, respectively. It also shares 42% and 36% aa identity with human Dkk-2 and Dkk-4, respectively. Dkk-1 and Dkk-4 are well-documented antagonists of the canonical Wnt signaling pathway. This pathway is activated by Wnt engagement of a receptor complex composed of the Frizzled proteins and one of two low-density lipoprotein receptor-related proteins, LRP5 or LRP6. Dkk-1 antagonizes Wnt by forming ternary complexes of LRP5/6 with Kremen1 or Kremen2. Dkk‑1/LRP6/Krm2 complex internalization has been shown to down-regulate Wnt signaling. Dkk-1 is expressed throughout development and antagonizes Wnt-7a during limb development. Other sites of expression include developing neurons, hair follicles, and the retina of the eye. The balance between Wnt signaling and Dkk-1 inhibition is critical for bone formation and homeostasis. Insufficient or excess Dkk-1 activity in bone results in increased or decreased bone density, respectively. In adults, Dkk-1 is expressed in osteoblasts and osteocytes, and neurons. Cerebral ischemia induces Dkk-1 expression, which contributes to neuronal cell death.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥95%(SDS-PAGE)
Bioactivity	Immobilized Recombinant Human Dkk-1 Protein (rp181236) at 1.0 μg/mL can bind Recombinant DKK1 Antibody (Ab099940) with the EC50 of 5.57 ng/mL.
Endotoxin Concentration	<1.0 EU/μg
Expression System	HEK293
Amino Acids	2-266 aa
Sequence	MALGAAGATRVFVAMVAAALGGHPLLGVSATLNSVLNSNAIKNLPPPLGGAAGHPGSAVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSSRLHTCQRHHHHHHH
Protein Tag	C-His
Accession #	O94907
Predicted molecular weight	26.6 kDa
SDS-PAGE	37.3-47.6 kDa, under reducing conditions; 42.4-60.6 kDa, under non-reducing conditions

Storage and Shipping

Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

ELISA: Recombinant Human Dkk-1 Protein (rp181236)

Recombinant Human Dkk-1 Protein (rp181236) - ELISA
Immobilized Recombinant Human Dkk-1 Protein (rp181236) at 1.0 μg/mL can bind Recombinant DKK1 Antibody (Ab099940) with the EC₅₀ of 5.57 ng/mL.

SDS-PAGE: Recombinant Human Dkk-1 Protein (rp181236)

Recombinant Human Dkk-1 Protein (rp181236) - SDS-PAGE
3 μg/lane of Recombinant Human Dkk-1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 37.3-47.6 kDa under reducing conditions and 42.4-60.6 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0707695	Certificate of Analysis	Jul 05, 2024	rp181236
ZJ24F0707694	Certificate of Analysis	Jul 05, 2024	rp181236
ZJ24F0707693	Certificate of Analysis	Jul 05, 2024	rp181236
ZJ24R0600683	Certificate of Analysis	Jun 14, 2024	rp181236

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration