Skip to the beginning of the images gallery

Recombinant Human Cytokeratin 5 Protein

COA

Grade & Purity:

Carrier Free

≥90%(SDS-PAGE)

Expression System: E. coli
Accession #: P13647
Protein Tag: N-His

In stock

Item Number

rp184127

Grouped product items
SKU	Size	Availability	Price
rp184127-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$89.90
rp184127-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$399.90
rp184127-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,599.90

Carrier Free, ≥90% (SDS-PAGE), E. coli, N-His tag, 258-590 aa

View related series

Click to view protein information: KRT5

Accession#:P13647 (5) Cytokeratin 5 (3) Gene ID:3852 (5) KRT5 (5)

Basic Description

Product Name	Recombinant Human Cytokeratin 5 Protein
Synonyms	58 kDa cytokeratin \| CK-5 \| CK5 \| Cytokeratin-5 \| Cytokeratin5 \| DDD \| DDD1 \| EBS2 \| epidermolysis bullosa simplex 2 Dowling-Meara/Kobner/Weber-Cockayne types \| K2C5_HUMAN \| K5 \| Keratin \| Keratin 5 \| keratin 5 (epidermolysis bullosa simplex, Dowling-Mear
Grade	Carrier Free
Specifications & Purity	Carrier Free, ≥90%(SDS-PAGE)
Biochemical and Physiological Mechanisms	Required for the formation of keratin intermediate filaments in the basal epidermis and maintenance of the skin barrier in response to mechanical stress.Regulates the recruitment of Langerhans cells to the epidermis, potentially by modulation of the abund
Expression System	E. coli
Amino Acids	258-590 aa
Sequence	MHHHHHHYEDEINKRTTAENEFVMLKKDVDAAYMNKVELEAKVDALMDEINFMKMFFDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIANRSRTEAESWYQTKYEELQQTAGRHGDDLRNTKHEISEMNRMIQRLRAEIDNVKKQCANLQNAIADAEQRGELALKDARNKLAELEEALQKAKQDMARLLREYQELMNTKLALDVEIATYRKLLEGEECRLSGEGVGPVNISVVTSSVSSGYGSGSGYGGGLGGGLGGGLGGGLAGGSSGSYYSSSSGGVGLGGGLSVGGSGFSASSGRGLGVGFGSGGGSSSSVKFVSTTSSSRKSFKS
Protein Tag	N-His
Accession #	P13647
Predicted molecular weight	36.5 kDa
SDS-PAGE	36.9 kDa, under reducing conditions; 37.2 kDa, under non-reducing conditions

Storage and Shipping

Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human Cytokeratin 5 Protein (rp184127)

Recombinant Human Cytokeratin 5 Protein (rp184127) - SDS-PAGE
2 μg/lane of Recombinant Human Cytokeratin 5 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 36.9 kDa under reducing conditions and 37.2 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration