Skip to the beginning of the images gallery

Recombinant Human CXCL5 Protein, ＞97% (SDS-PAGE, HPLC), high purity

Grade & Purity:

≥97%(SDS-PAGE&HPLC)

Expression System: E.coli
Accession #: P42830
Protein Tag: No tag
Bioactivity: Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/ml.
Endotoxin Concentration: <0.1 EU/μg

In stock

Item Number

rp144864

Grouped product items
SKU	Size	Availability	Price
rp144864-10μg	10μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$99.90
rp144864-50μg	50μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$339.90
rp144864-100μg	100μg	Available within 4-8 weeks(?) Items will be manufactured post-order and can take 4-8 weeks. Thank you for your patience!	$539.90
rp144864-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,399.90

Animal Free, >97% (SDS-PAGE, HPLC), Active, E. coli, No tag, 41-114 aa

View related series

Click to view protein information: CXCL6 Click to view protein information: CXCL5

Accession#:P42830 (3) CXCL5 (3) Gene ID:6374 (3)

Basic Description

Product Name	Recombinant Human CXCL5 Protein, ＞97% (SDS-PAGE, HPLC), high purity
Synonyms	chemokine (C-C motif) ligand 5 \| C-X-C motif chemokine 5 \| CXCL5 \| CXCL5/ENA-78 \| ENA78 \| ENA-78 \| ENA-78(1-78) \| Epithelial-derived neutrophil-activating protein 78 \| Neutrophil-activating peptide ENA-78 \| neutrophil-activating protein 78 \| SCYB5ENA78 \|
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity >97% SDS-PAGE or HPLC analyses. Endotoxin level is Less than 0.1EU/µg . Function Involved in neutrophil activation. In vitro, ENA-78(8-78) and ENA-78(9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. Post-translational N-terminal processed forms ENA-78(8-78) and ENA-78(9-78) are produced by proteolytic cleavage after secretion from peripheral blood monocytes. CXCL5 is a small cytokine also known as epithelial-derived neutrophil-activating peptide 78 (ENA-78). The protein is produced following stimulation of cells with the inflammatory cytokine interleukin-1 or tumor necrosis factor-alpha. In vitro, ENA-78 (8-78) and ENA-78 (9-78) show a threefold higher chemotactic activity for neutrophil granulocytes. They are produced by proteolytic cleavage after secretion from peripheral blood monocytes. Recombinant human CXCL5 (5-78 a.a.) contains 74 amino acids and it is a single non-glycosylated polypeptide chain. Human CXCL5 shares 57% amino acid sequence identity with mouse and rat CXCL5. Recombinant Human ENA-78/CXCL5 is an 8.1kDa protein containing 74 amino acid residues.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥97%(SDS-PAGE&HPLC)
Purity	＞97% (SDS-PAGE, HPLC)
Bioactivity	Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/ml.
Endotoxin Concentration	<0.1 EU/μg
Expression System	E.coli
Species	Human
Amino Acids	41-114 aa
Sequence	AAVLRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Protein Tag	No tag
Accession #	P42830
Predicted molecular weight	8.1 kDa

Storage and Shipping

Shape	Lyophilized
Reconstitution	This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Upon receipt, it is recommended to aliquot. Store at -20°C, Avoid freeze / thaw cycles.

Images

Protein Bioactivity: Recombinant Human CXCL5 Protein (rp144864)

Recombinant Human CXCL5 Protein ( rp144864) - Protein Bioactivity
Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human peripheral blood neutrophils is in a concentration of 10.0-100.0 ng/mL.

SDS-PAGE: Recombinant Human CXCL5 Protein (rp144864)

Recombinant Human CXCL5 Protein ( rp144864) - SDS-PAGE
2.5 μg/lane of Recombinant Human CXCL5 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 9.4 kDa under reducing conditions and 12.0 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ23F0901074	Certificate of Analysis	Sep 18, 2023	rp144864
ZJ23F0901073	Certificate of Analysis	Sep 18, 2023	rp144864
ZJ23F0901072	Certificate of Analysis	Sep 18, 2023	rp144864

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration