Skip to the beginning of the images gallery

Recombinant Human CD72 Protein

COA

Grade & Purity:

Animal Free

Carrier Free

≥90%(SDS-PAGE)

Expression System: HEK293
Accession #: P21854
Protein Tag: C-His
Bioactivity: Testing in progress
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp181592

Grouped product items
SKU	Size	Availability	Price
rp181592-10μg	10μg	≥10	$139.90
rp181592-50μg	50μg	2	$399.90
rp181592-100μg	100μg	2	$599.90
rp181592-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,999.90

Animal Free, ≥90% (SDS-PAGE), 293F cell, C-His tag, 117-359 aa

View related series

Click to view protein information: CD72

Accession#:P21854 (2) CD72 (2) Gene ID:971 (2)

Basic Description

Product Name	Recombinant Human CD72 Protein
Synonyms	CD72 antigen \| B-cell differentiation antigen CD72 \| B cell differentiation antigen CD72 \| CD72 molecule \| CD72_HUMAN \| CD72 \| CD72b \| Ly-19.2 \| Ly-32.2 \| Lyb-2 \| LYB2 \| lyb-2 \| Lyb2
Grade	Animal Free, Carrier Free
Product Description	CD72, also known as Lyb‑2, is a 40‑45 kDa type II transmembrane glycoprotein that plays a role in immune system regulation. Mature human CD72 consists of a 95 amino acid (aa) cytoplasmic domain with two immunoreceptor tyrosine‑based inhibitory motifs (ITIMs), a 21 aa transmembrane segment, and a 243 aa extracellular domain with a coiled‑coil domain and a C‑type lectin domain. Within the ECD, human CD72 shares 48% and 44% aa sequence identity with mouse and rat CD72, respectively. CD72 is expressed on B lineage cells, NK cells, monocytes, dendritic cells, and mast cells. CD72 binds to CD5 with mouse/human cross‑reactivity and to Semaphorin 4D/CD100. It associates with CD79A in the B cell antigen receptor (BCR) complex following antigen stimulation and dampens BCR signaling through interactions with the phosphatase SHP‑1. CD72 ligation with antibodies or with Semaphorin 4D induces tyrosine dephosphorylation of the CD72 cytoplasmic domain and its dissociation from SHP‑1, leading to B cell proliferation. Both CD72 and Semaphorin 4D are required for the maintenance of B cell anergy and the regulation of peripheral B cell tolerance as shown by the development of autoimmunity in mice that lack either molecule. In addition to its negative regulation of BCR signaling, CD72 can induce positive signaling in B cells independent of the BCR. CD72 binding to Semaphorin 4D induces cytokine production by monocytes and dendritic cells, inhibits SCF R/c‑kit induced mast cell proliferation and activation, and inhibits the cytolytic activity of NK cells. Semaphorin 4D is expressed on activated NK cells and contributes to the adhesive interaction between NK and CD72+ target cells leading to a more efficient killing and enhanced IFN-gamma secretion.
Specifications & Purity	Animal Free, Carrier Free, ≥90%(SDS-PAGE)
Bioactivity	Testing in progress
Endotoxin Concentration	<1.0 EU/μg
Expression System	HEK293
Amino Acids	117-359 aa
Sequence	RYLQVSQQLQQTNRVLEVTNSSLRQQLRLKITQLGQSAEDLQGSRRELAQSQEALQVEQRAHQAAEGQLQACQADRQKTKETLQSEEQQRRALEQKLSNMENRLKPFFTCGSADTCCPSGWIMHQKSCFYISLTSKNWQESQKQCETLSSKLATFSEIYPQSHSYYFLNSLLPNGGSGNSYWTGLSSNKDWKLTDDTQRTRTYAQSSKCNKVHKTWSWWTLESESCRSSLPYICEMTAFRFPDHHHHHH
Protein Tag	C-His
Accession #	P21854
Predicted molecular weight	28.9 kDa
SDS-PAGE	30.6-37.0 kDa, under reducing conditions

Storage and Shipping

Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.1 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human CD72 Protein (rp181592)

Recombinant Human CD72 Protein (rp181592) - SDS-PAGE
3 μg/lane of Recombinant Human CD72 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 30.6-37.0 kDa.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0707709	Certificate of Analysis	Jul 05, 2024	rp181592
ZJ24F0707710	Certificate of Analysis	Jul 05, 2024	rp181592
ZJ24F0707711	Certificate of Analysis	Jul 05, 2024	rp181592
ZJ24R0600646	Certificate of Analysis	Jun 10, 2024	rp181592

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration