Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp176727-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$139.90
|
|
|
rp176727-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$399.90
|
|
|
rp176727-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$639.90
|
|
|
rp176727-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$4,899.90
|
|
Animal Free, ≥95% (SDS-PAGE), Active, 293F cell, C-His tag, 1-372 aa
| Product Name | Recombinant Human CD5 Protein |
|---|---|
| Synonyms | CD5 antigen | CD5 antigen (p56-62) | CD5 molecule | CD5 | LEU1T-cell surface glycoprotein CD5 | Lymphocyte antigen T1/Leu-1 | T1 |
| Grade | ActiBioPure™, Animal Free, Bioactive, Carrier Free |
| Product Description |
The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. CD5 is a member of the CD system. CD5 was found to be widely distributed in T-cells and B1 cells which is a subset of IgM-secreting B cells. CD5 also was found expressed in small lymphocytic lymphoma, hairy cell leukaemia and mantle cell lymphoma cells. CD5 serves to weaken the activating stimulus from the BCR so that the B1 cells can only reflect to the very strong stimuli but not the normal tissue proteins. |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥95%(SDS-PAGE) |
| Bioactivity | Immobilized Recombinant Human CD5 Protein (rp176727) at 1.0 μg/mL can bind CD5 Mouse mAb (Ab006673) with the EC50 of 11.62 ng/mL. |
| Endotoxin Concentration | <1.0 EU/μg |
| Expression System | HEK293 |
| Amino Acids | 1-372 aa |
| Sequence | MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPHHHHHHHHHH |
| Protein Tag | C-His |
| Accession # | P06127 |
| Predicted molecular weight | 42.3 kDa |
| SDS-PAGE | 51.9 kDa, under reducing conditions; 48.0 kDa, under non-reducing conditions |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions. |
|---|---|
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20°C for 1 year. Avoid freeze / thaw cycle. |
Recombinant Human CD5 Protein (rp176727) - ELISA
Immobilized Recombinant Human CD5 Protein (rp176727) at 1.0 μg/mL can bind CD5 Mouse mAb (Ab006673) with the EC50 of 11.62 ng/mL.
Recombinant Human CD5 Protein (rp176727) - SDS-PAGE
3 μg/lane of Recombinant Human CD5 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 51.9 kDa under reducing conditions and 48.0 kDa under non-reducing conditions.
Find and download the COA for your product by matching the lot number on the packaging.
| Lot Number | Certificate Type | Date | Item |
|---|---|---|---|
| Certificate of Analysis | Aug 02, 2024 | rp176727 |
Starting at $99.90