Skip to the beginning of the images gallery

Recombinant Human CD33 Protein, ＞95%(SDS-PAGE), high purity

Grade & Purity:

≥95%(SDS-PAGE)

Expression System: HEK293
Accession #: P20138
Protein Tag: C-Fc & His
Bioactivity: 1、Measured by the ability of the immobilized protein to support the adhesion of human red blood cells. The ED50 for this effect is 1‑4 µg/mL. 2、Immobilized Recombinant Human CD33 Protein (rp143966) at 2.0 μg/mL can bind Gemtuzumab (anti-CD33) (Ab175859). The ED50 for this effect is 391.3 ng/mL.
Endotoxin Concentration: <0.1 EU/μg

In stock

Item Number

rp143966

Grouped product items
SKU	Size	Availability	Price
rp143966-10μg	10μg	≥10	$69.90
rp143966-50μg	50μg	8	$299.90
rp143966-100μg	100μg	3	$499.90
rp143966-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,599.90

Animal Free, >95%(SDS-PAGE), Active, 293F , Fc&His tag, 18-267 aa

View related series

Click to view protein information: CD33

Accession#:P20138 (11) CD33 (12) Gene ID:945 (11)

Basic Description

Product Name	Recombinant Human CD33 Protein, ＞95%(SDS-PAGE), high purity
Synonyms	CD33 antigen (gp67) \| CD33 antigen \| CD33 molecule \| CD33 \| FLJ00391 \| gp67 \| myeloid cell surface antigen CD33 \| p67 \| sialic acid binding Ig-like lectin 3 \| Sialic acid-binding Ig-like lectin 3 \| Siglec3 \| Siglec-3 \| SIGLEC3gp67
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity >95% SDS-PAGE Additional sequence information Fc, 6His tag at the C-terminus. Function Putative adhesion molecule of myelomonocytic-derived cells that mediates sialic-acid dependent binding to cells. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. In the immune response, may act as an inhibitory receptor upon ligand induced tyrosine phosphorylation by recruiting cytoplasmic phosphatase(s) via their SH2 domain(s) that block signal transduction through dephosphorylation of signaling molecules. Induces apoptosis in acute myeloid leukemia (in vitro). Post-translational Phosphorylation of Tyr-340 is involved in binding to PTPN6 and PTPN11. Phosphorylation of Tyr-358 is involved in binding to PTPN6.
Specifications & Purity	ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
Purity	＞95%(SDS-PAGE)
Bioactivity	1、Measured by the ability of the immobilized protein to support the adhesion of human red blood cells. The ED50 for this effect is 1‑4 µg/mL. 2、Immobilized Recombinant Human CD33 Protein (rp143966) at 2.0 μg/mL can bind Gemtuzumab (anti-CD33) (Ab175859). The ED50 for this effect is 391.3 ng/mL.
Endotoxin Concentration	<0.1 EU/μg
Expression System	HEK293
Species	Human
Amino Acids	18-267 aa
Sequence	DPNFWLQVQESVTVQEGLCVLVPCTFFHPIPYYDKNSPVHGYWFREGAIISRDSPVATNKLDQEVQEETQGRFRLLGDPSRNNCSLSIVDARRRDNGSYFFRMERGSTKYSYKSPQLSVHVTDLTHRPKILIPGTLEPGHSKNLTCSVSWACEQGTPPIFSWLSAAPTSLGPRTTHSSVLIITPRPQDHGTNLTCQVKFAGAGVTTERTIQLNVTYVPQNPTTGIFPGDGSGKQETRAGVVHENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Protein Tag	C-Fc & His
Accession #	P20138
Predicted molecular weight	54 kDa
SDS-PAGE	71.0 kDa, under reducing conditions ; 150.7 kDa, under non-reducing conditions.

Storage and Shipping

Shape	Lyophilized
Reconstitution	Reconstitute in water to a concentration of 0.1-0.5 mg/ml.
Storage Temp	Store at -20°C
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20~-80℃ for more than 1 year

Images

Protein Bioactivity: Recombinant Human CD33 Protein (rp143966)

Recombinant Human CD33 Protein (rp143966) - Protein Bioactivity
Immobilized Recombinant Human CD33 Protein (rp143966) at 2.0 μg/mL can bind CD33 Mouse mAb (Ab006571). The ED₅₀ for this effect is 251.9 ng/mL.

Protein Bioactivity: Recombinant Human CD33 Protein (rp143966)

Recombinant Human CD33 Protein (rp143966) - Protein Bioactivity
Immobilized Recombinant Human CD33 Protein (rp143966) at 2.0 μg/mL can bind Gemtuzumab (anti-CD33) (Ab175859). The ED₅₀ for this effect is 391.3 ng/mL.

SDS-PAGE: Recombinant Human CD33 Protein (rp143966)

Recombinant Human CD33 Protein (rp143966) - SDS-PAGE
3 μg/lane of Recombinant Human CD33 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 71.0 kDa under reducing conditions and 150.7 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0505377	Certificate of Analysis	May 15, 2024	rp143966
ZJ24F0505376	Certificate of Analysis	May 15, 2024	rp143966
ZJ24F0505375	Certificate of Analysis	May 15, 2024	rp143966

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration