Determine the necessary mass, volume, or concentration for preparing a solution.
This is a demo store. No orders will be fulfilled.
| SKU | Size | Availability |
Price | Qty |
|---|---|---|---|---|
|
rp143943-10μg
|
10μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$99.90
|
|
|
rp143943-50μg
|
50μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$299.90
|
|
|
rp143943-100μg
|
100μg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$499.90
|
|
|
rp143943-1mg
|
1mg |
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
|
$2,599.90
|
|
Animal Free, ≥95% (SDS-PAGE), Active, 293F, C-His tag, 21-183 aa
| Product Name | Recombinant Human CD300c Protein, ≥95% (SDS-PAGE), high purity |
|---|---|
| Synonyms | CD300 antigen-like family member C | CLM-6 | CMRF-35 | CMRF35-A1 | IgSF16 | Immunoglobulin superfamily member 16 | CD300 antigen-like family member C | CD300c | CD300c antigen | CD300c molecule | CLM-6 | CLM6_HUMAN | CMRF-35 | CMRF-35A | CMRF35 | CMRF35 a |
| Grade | ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance |
| Product Description |
Purity |
| Specifications & Purity | ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE) |
| Purity | ≥95% (SDS-PAGE) |
| Bioactivity | Measured by its ability to inhibit anti-CD3-induced proliferation of stimulated human T cells. Human T lymphocytes cultured for 72 hours with PHA were incubated for an additional 3 days in 96 well plates coated with 500 ng/mL antiCD3 and Recombinant Human CD300c Fc Chimera. The ED50 for this effect is 4-16 μg/mL. |
| Endotoxin Concentration | <0.1 EU/μg |
| Expression System | HEK293 |
| Species | Human |
| Amino Acids | 21-183 aa |
| Sequence | GYFPLSHPMTVAGPVGGSLSVQCRYEKEHRTLNKFWCRPPQILRCDKIVETKGSAGKRNGRVSIRDSPANLSFTVTLENLTEEDAGTYWCGVDTPWLRDFHDPIVEVEVSVFPAGTTTASSPQSSMGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRHHHHHH |
| Protein Tag | C-His |
| Accession # | Q08708 |
| Predicted molecular weight | 45 kDa |
| SDS-PAGE | 40 - 50 kDa, under reducing conditions; 40 - 50 kDa, under non-reducing conditions. |
| Shape | Lyophilized |
|---|---|
| Reconstitution | Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml. |
| Storage Temp | Store at -20°C,Avoid repeated freezing and thawing |
| Shipped In | Ice chest + Ice pads |
| Stability And Storage | Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle. |
Recombinant Human CD300c Protein (rp143943) - SDS-PAGE
3 μg/lane of Recombinant Human CD300c Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 40 - 50 kDa.