This is a demo store. No orders will be fulfilled.

Recombinant Human CD30-L Protein, ≥95% (SDS-PAGE), high purity

  • Expression System: HEK293
  • Accession #: P32971
  • Protein Tag: N-His
  • Bioactivity: Measured by its ability to stimulate IL-6 secretion by HDLM human Hodgkin’s lymphoma cells. The ED50 for this effect is 8-48 ng/mL in the presence of 10 µg/mL of a cross-linking antibody, Mouse Anti-polyHistidine Monoclonal Antibody.
  • Endotoxin Concentration: <0.1 EU/μg
In stock
Item Number
rp143950
Grouped product items
SKU Size
Availability
Price Qty
rp143950-10μg
10μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$79.90
rp143950-50μg
50μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$199.90
rp143950-100μg
100μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$309.90
rp143950-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$1,599.90

Animal Free, ≥95% (SDS-PAGE), Active, 293F, N-His tag, 63-234 aa

Basic Description

Product Name Recombinant Human CD30-L Protein, ≥95% (SDS-PAGE), high purity
Synonyms CD153 antigen; CD153; CD30 antigen ligand; CD30 Ligand; CD30L; CD30-L; CD30LCD30 ligand; CD30LGMGC138144; TNFSF8; tumor necrosis factor (ligand) superfamily, member 8; tumor necrosis factor ligand superfamily member 8; CD30LG; TNLG3A
Grade ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description

Purity
≥95% SDS-PAGE.
Endotoxin level
<0.1 EU/µg
Function
Cytokine that binds to TNFRSF8/CD30. Induces proliferation of T-cells.

Specifications & Purity ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE)
Purity ≥95% (SDS-PAGE)
Bioactivity Measured by its ability to stimulate IL-6 secretion by HDLM human Hodgkin’s lymphoma cells. The ED50 for this effect is 8-48 ng/mL in the presence of 10 µg/mL of a cross-linking antibody, Mouse Anti-polyHistidine Monoclonal Antibody.
Endotoxin Concentration <0.1 EU/μg
Expression System HEK293
Species Human
Amino Acids 63-234 aa
Sequence HHHHHHQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Protein Tag N-His
Accession # P32971
Predicted molecular weight 10 kDa
SDS-PAGE 20 - 38 kDa, under reducing conditions; 20 - 38 kDa, under non-reducing conditions.

Storage and Shipping

Shape Lyophilized
Reconstitution Reconstitute in sterile water to a concentration of 0.1-0.5 mg/ml.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20~-80℃ for more than 1 year. Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Images

Recombinant Human CD30-L Protein (rp143950) - SDS-PAGE
2 μg/lane of Recombinant Human CD30-L Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing the band at 20 - 38 kDa.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.