This is a demo store. No orders will be fulfilled.

Recombinant Human BTLA Protein, ≥95% (SDS-PAGE), high purity

  • Expression System: HEK293
  • Accession #: Q7Z6A9-2
  • Protein Tag: C-Fc & His
  • Bioactivity: Immobilized Recombinant human BTLA at 3 μg/mL (100 μL/well) can bind Biotinylated Recombinant human HVEM with a linear range of 18-72 ng/mL.
  • Endotoxin Concentration: <0.1 EU/μg
In stock
Item Number
rp143904
Grouped product items
SKU Size
Availability
Price Qty
rp143904-10μg
10μg
≥10
$79.90
rp143904-50μg
50μg
8
$199.90
rp143904-100μg
100μg
3
$309.90
rp143904-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$2,309.90

Animal Free, ≥95% (SDS-PAGE), Active, HEK293, C-Fc&His tag, 31-134 aa

Basic Description

Product Name Recombinant Human BTLA Protein, ≥95% (SDS-PAGE), high purity
Synonyms B and T lymphocyte associated | B and T lymphocyte attenuator | B- and T-lymphocyte attenuator | B- and T-lymphocyte-associated protein | BTLA | BTLA1 | CD272 antigen | CD272 | FLJ16065 | MGC129743
Grade ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free
Product Description

Purity
≥95% SDS-PAGE.
Endotoxin level
<0.1 EU/µg
Function
Lymphocyte inhibitory receptor which inhibits lymphocytes during immune response.

Specifications & Purity ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, ≥95%(SDS-PAGE)
Purity ≥95% (SDS-PAGE)
Bioactivity Immobilized Recombinant human BTLA at 3 μg/mL (100 μL/well) can bind Biotinylated Recombinant human HVEM with a linear range of 18-72 ng/mL.
Endotoxin Concentration <0.1 EU/μg
Expression System HEK293
Species Human
Amino Acids 31-134 aa
Sequence KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTENLYFQGMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
Protein Tag C-Fc & His
Accession # Q7Z6A9-2
Predicted molecular weight 39 kDa
SDS-PAGE 50-60 kDa, under reducing conditions

Storage and Shipping

Shape Lyophilized
Reconstitution Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20~-80℃ for more than 1 year.Upon receipt, it is recommended to aliquot. Avoid freeze/thaw cycle.

Images

Recombinant Human BTLA Protein (rp143904) - Protein Bioactivity
Immobilized Recombinant Human BTLA Protein (rp143904) at 3.0 μg/mL can bind Biotinylated Recombinant Human HVEM with a linear range of 18 - 75 ng/mL.

Recombinant Human BTLA Protein (rp143904) - SDS-PAGE
3 μg/lane of Recombinant Human BTLA Protein was resolved with SDS-PAGE under reducing (R) condition and visualized by Coomassie® Blue staining, showing a band at 50.0 - 60.0 kDa under reducing condition.

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number Certificate Type Date Item
ZJ24F0404868 Certificate of Analysis Apr 26, 2024 rp143904
ZJ24F0404867 Certificate of Analysis Apr 26, 2024 rp143904
ZJ24F0404866 Certificate of Analysis Apr 26, 2024 rp143904

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.