Skip to the beginning of the images gallery

Recombinant Feline CD19 Protein

COA

Grade & Purity:

Carrier Free

≥95%(SDS-PAGE)

Expression System: E. coli
Accession #: M3VZQ6
Protein Tag: C-His

In stock

Item Number

rp176267

Grouped product items
SKU	Size	Availability	Price
rp176267-10μg	10μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$99.90
rp176267-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$499.90
rp176267-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$2,599.90

Carrier Free, ≥95% (SDS-PAGE), E. coli, C-His tag, 104-375 aa

View related series

Click to view protein information: CD19

Accession#: M3VZQ6 (1) CD19 (52) Gene ID: 100125860 (1)

Basic Description

Product Name	Recombinant Feline CD19 Protein
Synonyms	B-lymphocyte antigen CD19 \| B-lymphocyte surface antigen B4 \| CD19 antigen \| CD19 molecule \| CD19 \| CVID3 \| Differentiation antigen CD19 \| Leu-12 \| MGC12802 \| T-cell surface antigen Leu-12 \| B4
Grade	Carrier Free
Product Description	Function Assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation. Post-translational Phosphorylated on serine and threonine upon DNA damage, probably by ATM or ATR. Phosphorylated on tyrosine following B-cell activation.
Specifications & Purity	Carrier Free, ≥95%(SDS-PAGE)
Expression System	E. coli
Amino Acids	104-375 aa
Sequence	MQKTLLVEAKEGGKAELPCLKGPSDGPPEQQAWFQGAQSELDPGSQGLGIQKGPLGLQLLIFNVSDQMGGFYVCQLGPPSEQAWQSGWTVTVEGSGELFRWNASYLNDPGCGLGNRSSEGPKPSSGYPTSSQLYVWAKGHPEIWETDPDCASPRGGLDQSLNQDVTVAPGSTFWLPCEVPPASVARGPISWTLVRPKKHNISLLHLNLREDAPVREMWVLDTLRGGAVLLLPQATAQDAGTYHCYHGNMTIEMQLKVTAQSVRHWLLEAGGWKHHHHHH
Protein Tag	C-His
Accession #	M3VZQ6
Predicted molecular weight	30.5 kDa
SDS-PAGE	30.1 and 62.9 kDa, under reducing conditions

Storage and Shipping

Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Feline CD19 Protein (rp176267)

Recombinant Feline CD19 Protein (rp176267) - SDS-PAGE
3 μg/lane of Recombinant Feline CD19 Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing two bands at 30.1 kDa and 62.9 kDa under reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration