Skip to the beginning of the images gallery

Recombinant Bovine CD4 Protein, >90% (SDS-PAGE), high purity

Grade & Purity:

≥90%(SDS-PAGE)

Expression System: HEK293
Accession #: F1MJK4
Protein Tag: C-His
Bioactivity: Measured by the ability of the immobilized protein to support the adhesion of NIH‑3T3 mouse embryonic fibroblast cells.The ED50for this effect is 0.1-0.5 μg/mL after a 1 hour incubation at37 °C.Optimal dilutions should be determined by each laboratory for each application.
Endotoxin Concentration: <1.0 EU/μg

In stock

Item Number

rp175916

Grouped product items
SKU	Size	Availability	Price
rp175916-10μg	10μg	10	$139.90
rp175916-50μg	50μg	2	$299.90
rp175916-100μg	100μg	1	$399.90
rp175916-1mg	1mg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$4,999.90

Animal Free, >90% (SDS-PAGE), 293F cell, C-His tag, 1-394 aa

View related series

Click to view protein information: CD4

Accession#: F1MJK4 (1) Bovine CD4 (1) Gene ID: 407098 (1)

Basic Description

Product Name	Recombinant Bovine CD4 Protein, >90% (SDS-PAGE), high purity
Synonyms	T-cell surface glycoprotein CD4 \| T-cell surface antigen T4/Leu-3 \| CD4
Grade	ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Product Description	Purity:> 90%, by SDS-PAGE visualized with Coomassie® Blue Staining. Description： CD4, also known as L3T4, T4, and W3/25, is an approximately 55 kDa type I transmembrane glycoprotein that is expressed predominantly on thymocytes and a subset of mature T lymphocytes. It is a standard phenotype marker for the identification of T cell populations. Mature feline CD4 consists of a 388 amino acid (aa) extracellular region containing four immunoglobulin-like domains, a 22 aa transmembrane segment, and a 40 aa cytoplasmic domain. Within the ECD, feline CD4 shares 70%, 58%, 50%, and 48% aa sequence identity with canine, human, mouse and rat CD4, respectively. CD4 is expressed along with CD8 on double positive T cells during their development in the thymus. Either CD4 or CD8 expression is then lost, giving rise to single positive (SP) CD4+ or CD8+ mature T cells. CD4+ SP cells, also known as T helper cells, further differentiate into multiple subsets of CD4+ cells including Th1, Th2, Th17, Tfh, and Treg cells which regulate humoral and cellular immunity. CD4 is reexpressed on circulating CD8+ T cells upon activation and contributes to their cytotoxic effector activity. In human, CD4 is additionally expressed on macrophages, neutrophils, monocytes, NK cells, and neurons and glial cells in the brain. Similar CD4 distribution between species cannot be assumed as demonstrated by its presence on macrophages in human and rat but not in mouse. CD4 binds directly to MHC class II molecules on antigen presenting cells. This interaction contributes to the formation of the immunological synapse which is focused around the TCR-MHC class II-antigenic peptide interaction. Palmitoylation of two cysteine residues in the cytoplasmic tail of CD4 promotes the localization of CD4 in lipid rafts and its ability to augment TCR signaling via activation of the tyrosine kinase Lck. CD4 also functions as a chemotactic receptor for IL-16 and, in human, as a coreceptor for the gp120 surface glycoprotein of HIV-1.
Specifications & Purity	Animal Free, Carrier Free, Azide Free, Bioactive, ActiBioPure™, High performance, ≥90%(SDS-PAGE)
Purity	>90% (SDS-PAGE)
Bioactivity	Measured by the ability of the immobilized protein to support the adhesion of NIH‑3T3 mouse embryonic fibroblast cells.The ED50for this effect is 0.1-0.5 μg/mL after a 1 hour incubation at37 °C.Optimal dilutions should be determined by each laboratory for each application.
Endotoxin Concentration	<1.0 EU/μg
Expression System	HEK293
Amino Acids	1-394 aa
Sequence	MGPGTSLRHLFLVLQLAMLPAGTQGKTVVLGEAGDKAELPCQASQKKNMVFSWKDSSQSNILGKRGLFFYKGTTELSHRVESKKNLWDQGSFPLIIKNLQVTDSGTYTCEVDKKTLEVELQVFRLTASSDTHVLLGQSLTLTLESPSGSNPSVQWKGPGDNNKRDVKSLSLAQVGLQDSGTWTCTISQSQQTLEIKIPIVVLAFQKAPETVYVKEGEQAEFSFPLTFEYENLSGELTWQLANGDSSSQSWVTFTVKNREVKVNKIHNDPKLLVGEKLPLRLTLPRTLPQHAGSGTLTLDLTKGKLQQKVKLVVMKVTKSPNSLTCEVLGPSPPKLTLNLKMGNQSMKGSNQPKLVTQPEPQAGMWQCLLSDNGKVLLEAKIEVLPSEFTQAWPKHHHHHH
Protein Tag	C-His
N-terminal Sequence	Ala22
Accession #	F1MJK4
Predicted molecular weight	41.6 kDa
SDS-PAGE	38.8-53.9 kDa, under reducing conditions; 37.1-51.0 kDa, under non-reducing conditions

Storage and Shipping

Shape	Lyophilized
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage Temp	Store at -20°C,Avoid repeated freezing and thawing
Shipped In	Ice chest + Ice pads
Stability And Storage	Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Bovine CD4 Protein (rp175916)

Recombinant Bovine CD4 Protein (rp175916) - SDS-PAGE
3 μg/lane of Recombinant Bovine CD4 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 38.8-53.9 kDa under reducing conditions and 37.1-51.0 kDa under non-reducing conditions.

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot Number	Certificate Type	Date	Item
ZJ24F0505231	Certificate of Analysis	May 10, 2024	rp175916
ZJ24F0505230	Certificate of Analysis	May 10, 2024	rp175916
ZJ24F0505229	Certificate of Analysis	May 10, 2024	rp175916

Documents & Articles

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration