This is a demo store. No orders will be fulfilled.

Leptin (mouse), (recombinant) - ≥95%, high purity , CAS No.181030-10-4

  • Accession #: Q544U0
  • Bioactivity: Immobilized Recombinant Mouse LEPR (C-10His) at 5μg/ml (100 μl/well) can bind Recombinant Mouse Leptin Biotinylated by NHS-biotin prior to testing.The ED50 of Recombinant Mouse Leptin is 1.16 ng/ml. Loaded Recombinant Mouse LEPR (C-10His) on HIS1K Biosensor, can bind Recombinant Mouse Leptin with an affinity constant of 0.196 nM as determined in BLI assay.
  • Endotoxin Concentration: <1.0 EU/μg
In stock
Item Number
L329647
Grouped product items
SKU Size
Availability
Price Qty
L329647-1mg
1mg
1
$459.90

Animal Free, ≥95% (SDS-PAGE), Active, E. coli, No tag, 22-167 aa

Basic Description

Product Name Leptin (mouse), (recombinant) - ≥95%, high purity , CAS No.181030-10-4
Synonyms FLJ94114 | LEP | leptin (murine obesity homolog) | leptin (obesity homolog, mouse) | Leptin | OB | Obese protein | obese, mouse, homolog of | Obesity factor | OBOBS | obese
Grade ActiBioPure™, Animal Free, Bioactive, Carrier Free
Specifications & Purity ActiBioPure™, Bioactive, Animal Free, Carrier Free, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic
Bioactivity Immobilized Recombinant Mouse LEPR (C-10His) at 5μg/ml (100 μl/well) can bind Recombinant Mouse Leptin Biotinylated by NHS-biotin prior to testing.The ED50 of Recombinant Mouse Leptin is 1.16 ng/ml. Loaded Recombinant Mouse LEPR (C-10His) on HIS1K Biosensor, can bind Recombinant Mouse Leptin with an affinity constant of 0.196 nM as determined in BLI assay.
Endotoxin Concentration <1.0 EU/μg
Amino Acids 22-167 aa
Sequence VPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC
Accession # Q544U0
Predicted molecular weight 16.1 KDa
SDS-PAGE 14 KDa, under reducing conditions.

Storage and Shipping

Reconstitution Always centrifuge tubes before opening.Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage Temp Store at -20°C,Avoid repeated freezing and thawing
Shipped In Ice chest + Ice pads
Stability And Storage Store at -20℃ long term (12 months). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
CAS 181030-10-4

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.