This is a demo store. No orders will be fulfilled.

lepirudin, Inhibitor of coagulation factor II; thrombin, CAS No.138068-37-8, Inhibitor of coagulation factor II; thrombin

In stock
Item Number
rp174441
Grouped product items
SKU Size
Availability
Price Qty
rp174441-500μg
500μg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$1,334.90
rp174441-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$2,334.90

Basic Description

Product Name lepirudin, Inhibitor of coagulation factor II; thrombin, CAS No.138068-37-8
Synonyms 1-L-Leucine-2-L-threonine-63-desulfohirudin | LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ | [Leu1, Thr2]-63-desulfohirudin | Lepirudin [INN:BAN] | Hirudin variant-1 | Refludan | Aventis Brand Lepirudin | 1-L-Leucine-2-L-threonine-63-
Grade Moligand™
Specifications & Purity Moligand™
Action Type INHIBITOR
Mechanism of action Inhibitor of coagulation factor II; thrombin

Taxonomic Classification

Taxonomy Tree

Kingdom Organic compounds
Superclass Organic acids and derivatives
Class Peptidomimetics
Subclass Hybrid peptides
Intermediate Tree Nodes Not available
Direct Parent Hybrid peptides
Alternative Parents Isoleucine and derivatives  N-acyl-alpha amino acids  Alpha amino acid amides  Amphetamines and derivatives  N-acylpyrrolidines  1-hydroxy-2-unsubstituted benzenoids  Cyclic carboximidic acids  Heteroaromatic compounds  Imidazoles  Tertiary carboxylic acid amides  Secondary alcohols  Organic disulfides  Amino acids  Azacyclic compounds  Carboxylic acids  Propargyl-type 1,3-dipolar organic compounds  Polyols  Carbonyl compounds  Hydrocarbon derivatives  Monoalkylamines  Organic oxides  Organopnictogen compounds  Primary alcohols  
Molecular Framework Aromatic heteropolycyclic compounds
Substituents Cyclic hybrid peptide - Isoleucine or derivatives - N-acyl-alpha amino acid or derivatives - N-acyl-alpha-amino acid - Alpha-amino acid amide - Alpha-amino acid or derivatives - Amphetamine or derivatives - N-acylpyrrolidine - 1-hydroxy-2-unsubstituted benzenoid - Phenol - Monocyclic benzene moiety - Benzenoid - Azole - Heteroaromatic compound - Pyrrolidine - Tertiary carboxylic acid amide - Imidazole - Cyclic carboximidic acid - Secondary alcohol - Organic disulfide - Carboxamide group - Amino acid or derivatives - Amino acid - Azacycle - Carboximidic acid - Carboximidic acid derivative - Organoheterocyclic compound - Carboxylic acid derivative - Carboxylic acid - Organic 1,3-dipolar compound - Propargyl-type 1,3-dipolar organic compound - Polyol - Organopnictogen compound - Amine - Organic oxygen compound - Organic nitrogen compound - Carbonyl group - Organic oxide - Hydrocarbon derivative - Primary aliphatic amine - Primary amine - Primary alcohol - Alcohol - Organooxygen compound - Organonitrogen compound - Aromatic heteropolycyclic compound
Description This compound belongs to the class of organic compounds known as hybrid peptides. These are compounds containing at least two different types of amino acids (alpha, beta, gamma, delta) linked to each other through a peptide bond.
External Descriptors Not available

Associated Targets(Human)

F2 Tclin Prothrombin (0 Activities)
Activity Type Activity Value -log(M) Mechanism of Action Activity Reference Publications (PubMed IDs)

Storage and Shipping

CAS 138068-37-8

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Genetic information

Alternate Names 1-L-Leucine-2-L-threonine-63-desulfohirudin | LTYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ | [Leu1, Thr2]-63-desulfohirudin | Lepirudin [INN:BAN] | Hirudin variant-1 | Refludan | Aventis Brand Lepirudin | 1-L-Leucine-2-L-threonine-63-
Reference
  • 1. Kinetics and inhibition of recombinant human cystathionine gamma-lyase. Toward the rational control of transsulfuration., The Journal of biological chemistry, Steegborn, C C and 7 more authors.
  • 2. Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences., Proceedings of the National Academy of Sciences of the United States of America, Strausberg, Robert L RL and 83 more authors.
  • 3. Genomic basis of cystathioninuria (MIM 219500) revealed by multiple mutations in cystathionine gamma-lyase (CTH)., Human genetics, Wang, Jian J and Hegele, Robert A RA.
  • 4. Cloning and nucleotide sequence of human liver cDNA encoding for cystathionine gamma-lyase., Biochemical and biophysical research communications, Lu, Y Y, O'Dowd, B F BF, Orrego, H H and Israel, Y Y.
  • 5. Single nucleotide polymorphism in CTH associated with variation in plasma homocysteine concentration., Clinical genetics, Wang, J J, Huff, A M AM, Spence, J D JD and Hegele, R A RA.
  • 6. Cystathionine gamma-lyase overexpression inhibits cell proliferation via a H2S-dependent modulation of ERK1/2 phosphorylation and p21Cip/WAK-1., The Journal of biological chemistry, Yang, Guangdong G, Cao, Kun K, Wu, Lingyun L and Wang, Rui R.
  • 7. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)., Genome research, Gerhard, Daniela S DS and 115 more authors.
  • 8. Towards a proteome-scale map of the human protein-protein interaction network., Nature, Rual, Jean-François JF and 37 more authors.
  • 9. The DNA sequence and biological annotation of human chromosome 1., Nature, Gregory, S G SG and 178 more authors.
  • 10. Polymorphisms in one-carbon metabolism and trans-sulfuration pathway genes and susceptibility to bladder cancer., International journal of cancer, Moore, Lee E LE and 14 more authors. more

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.