Skip to the beginning of the images gallery

Huwentoxin IV, CAS No.526224-73-7

COA

In stock

Item Number

H287997

Grouped product items
SKU	Size	Availability	Price	Qty
H287997-100μg	100μg	Available within 8-12 weeks(?) Production requires sourcing of materials. We appreciate your patience and understanding.	$756.90

Selective NaV1.7 channel blocker

View related series

Ion channel (2197)

Basic Description

Product Name	Huwentoxin IV, CAS No.526224-73-7
Biochemical and Physiological Mechanisms	Selective NaV1.7 channel blocker. Preferentially inhibits neuronal NaV1.7, 1.2 and 1.3 (IC50values are 26, 150 and 338 nM respectively), compared to muscle subtypes NaV1.4 and 1.5 (IC50= >10μM). Inhibits the channel by binding at the neurotoxin receptor s
Sequence	ECLEIFKACNPSNDQCCKSSKLVCSRKTRWCKYQI(Modifications: Disulfide bridge: 2-17,9-24,16-31)(Modifications: Ile-35 = C-terminal amide)

Storage and Shipping

Storage Temp	Store at -20°C
Shipped In	Ice chest + Ice pads
CAS	526224-73-7

Certificates（CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):

Analytical Chart:

Solution Calculators

Molarity Calculator

Determine the necessary mass, volume, or concentration for preparing a solution.

Mass

Concentration

Volume

M. Wt*

g/mol

*When preparing stock solutions, always use the batch-specific molecular weight of the product found on the vial label and the Certificate of Analysis (available online).

Dilution Calculator

Determine the dilution needed to prepare a stock solution.

Concentration 1 (C1)

Volume 1 (V1)

Concentration 2 (C2)

Volume 2 (V2)

Reconstitution Calculator

The reconstitution calculator enables you to quickly determine the volume of a reagent needed to reconstitute your vial. Just enter the mass of the reagent and the target concentration, and the calculator will do the rest.

Volume (to add to vial)

Mass (in vial)

Desired Reconstitution Concentration