This is a demo store. No orders will be fulfilled.

GIP(1-39) TFA, CAS No.725474-97-5(free)

    Grade & Purity:
  • ≥98%
In stock
Item Number
G286726
Grouped product items
SKU Size
Availability
Price Qty
G286726-1mg
1mg
Available within 8-12 weeks(?)
Production requires sourcing of materials. We appreciate your patience and understanding.
$355.90

Highly potent insulinotropic peptide; GIP agonist

Basic Description

Product Name GIP(1-39) TFA, CAS No.725474-97-5(free)
Synonyms Gastric Inhibitory Polypeptide (1-39)
Specifications & Purity ≥98%
Sequence YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN

Storage and Shipping

Storage Temp Store at -20°C,Desiccated
Shipped In Ice chest + Ice pads
CAS 725474-97-5(free)

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.