The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser.
For the best experience on our site, be sure to turn on Javascript in your browser.
This is a demo store. No orders will be fulfilled.
We use cookies to keep things working smoothly and to improve your experience.
Choose what’s okay for you below. See our Cookie Policy .
Accept Cookies
Cecropin A, CAS No.80451-04-3
an antibacterial peptide originally identified in moths
Basic Description
Product Name
Cecropin A, CAS No.80451-04-3
Synonyms
cecA1 protein, Drosophila | P9A Protein | DTXSID30230333 | dyak protein, Drosophila | cecropin A2 protein, Drosphila | Cecropin A (trifluoroacetate salt) | Cecropin A (1-33), DTXSID80231193, 81541-05-1 | Cecropin A | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-
Product Description
Cecropin A is an antibacterial peptide originally identified in moths (|Hyalophora cecropia|) and later in pig intestine.
Sequence
Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2
Taxonomic Classification
Kingdom
Organic compounds
Superclass
Organic Polymers
Class
Polypeptides
Subclass
Not available
Intermediate Tree Nodes
Not available
Direct Parent
Polypeptides
Alternative Parents
Peptides Arginine and derivatives Phenylalanine and derivatives Glutamic acid and derivatives Glutamine and derivatives Asparagine and derivatives Aspartic acid and derivatives Isoleucine and derivatives Leucine and derivatives Valine and derivatives N-acyl-alpha amino acids and derivatives Proline and derivatives Tryptamines and derivatives Alpha amino acid amides Alanine and derivatives 3-alkylindoles Amphetamines and derivatives N-acylpyrrolidines Pyrrolidinecarboxamides N-acyl amines Dicarboxylic acids and derivatives Substituted pyrroles Tertiary carboxylic acid amides Heteroaromatic compounds Primary carboxylic acid amides Secondary alcohols Amino acids Secondary carboxylic acid amides Guanidines Carboximidamides Carboxylic acids Azacyclic compounds Carbonyl compounds Hydrocarbon derivatives Imines Monoalkylamines Organic oxides
Molecular Framework
Aromatic heteropolycyclic compounds
Substituents
Polypeptide - Alpha peptide - Arginine or derivatives - Phenylalanine or derivatives - Glutamic acid or derivatives - Glutamine or derivatives - Asparagine or derivatives - Aspartic acid or derivatives - Isoleucine or derivatives - Leucine or derivatives - N-acyl-alpha amino acid or derivatives - Valine or derivatives - Proline or derivatives - Triptan - Alpha-amino acid amide - Alanine or derivatives - Alpha-amino acid or derivatives - Amphetamine or derivatives - N-substituted-alpha-amino acid - 3-alkylindole - Indole - Indole or derivatives - N-acylpyrrolidine - Pyrrolidine carboxylic acid or derivatives - Pyrrolidine-2-carboxamide - Monocyclic benzene moiety - Dicarboxylic acid or derivatives - Fatty acyl - Fatty amide - Substituted pyrrole - Benzenoid - N-acyl-amine - Heteroaromatic compound - Pyrrole - Pyrrolidine - Tertiary carboxylic acid amide - Amino acid or derivatives - Amino acid - Carboxamide group - Guanidine - Secondary carboxylic acid amide - Secondary alcohol - Primary carboxylic acid amide - Carboximidamide - Carboxylic acid derivative - Carboxylic acid - Organoheterocyclic compound - Azacycle - Organooxygen compound - Organic oxide - Imine - Organic oxygen compound - Carbonyl group - Hydrocarbon derivative - Amine - Primary aliphatic amine - Alcohol - Organic nitrogen compound - Primary amine - Organonitrogen compound - Aromatic heteropolycyclic compound
Description
This compound belongs to the class of organic compounds known as polypeptides. These are peptides containing ten or more amino acid residues.
External Descriptors
Not available
Data sources
1. Djoumbou Feunang Y, Eisner R, Knox C, Chepelev L, Hastings J, Owen G, Fahy E, Steinbeck C, Subramanian S, Bolton E, Greiner R, and Wishart DS. ClassyFire: Automated Chemical Classification With A Comprehensive, Computable Taxonomy. Journal of Cheminformatics, 2016, 8:61.
Mechanisms of Action
Mechanism of Action
Action Type
target ID
Target Name
Target Type
Target Organism
Binding Site Name
References
Storage and Shipping
Storage Temp
Store at -20°C
Shipped In
Ice chest + Ice pads
CAS
80451-04-3
Certificates（CoA,COO,BSE/TSE and Analysis Chart)
Citations of This Product
Solution Calculators
Molarity Calculator
Determine the necessary mass, volume, or concentration for preparing a solution.
Dilution Calculator
Determine the dilution needed to prepare a stock solution.
Reconstitution Calculator
Shall we send you a message when we have discounts available?
Remind me later
Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
1 Citations