This is a demo store. No orders will be fulfilled.

 
Call +1 (833) 552-7181 or Contact us
Toggle Nav
My Cart
Search
Advanced Search
Menu
Account
Settings
྾

Search results for: '25988-63-0'

View as List Grid

Items 121-144 of 550

Set Ascending Direction
  1. Ethyl 4-((tert-butoxycarbonyl)amino)-1-methyl-1H-imidazole-2-carboxylate
    Cas Number:  128293-63-0
    Formula:  C12H19N3O4
    Molecular weight:  269.3
    SMILES:  CCOC(=O)C1=NC(=CN1C)NC(=O)OC(C)(C)C
    InChIKey:  VKDFVUFMCCONBE-UHFFFAOYSA-N
    InChI:  InChI=1S/C12H19N3O4/c1-6-18-10(16)9-13-8(7-15(9)5)14-11(17)19-12(2,3)4/h7H,6H2,1-5H3,(H,14,17)
  2. Isopropyl Alcohol（IPA）
    2103 Citations
    Cas Number:  67-63-0       EC Number: 200-661-7
    Formula:  C3H8O
    Molecular weight:  60.10
    Synonyms:  1-Methylethyl alcohol | 2-Propanol, anhydrous | Isopropyl alcohol, rubbing | sparkle | Combi-schutz ...
    SMILES:  CC(C)O
    InChIKey:  KFZMGEQAYNKOFK-UHFFFAOYSA-N
    InChI:  InChI=1S/C3H8O/c1-3(2)4/h3-4H,1-2H3
  3. 3-Methyl-5-(tributylstannyl)pyridine
    Cas Number:  167556-63-0
    Formula:  C18H33NSn
    Molecular weight:  382.17
    SMILES:  CCCC[Sn](CCCC)(CCCC)C1=CN=CC(=C1)C
    InChIKey:  LCXALGLSLCXDRT-UHFFFAOYSA-N
    InChI:  InChI=1S/C6H6N.3C4H9.Sn/c1-6-3-2-4-7-5-6;3*1-3-4-2;/h3-5H,1H3;3*1,3-4H2,2H3;
  4. 3-Benzyl-3-azabicyclo[3.1.0]hexane-2,4-dione
    Cas Number:  73799-63-0
    Formula:  C12H11NO2
    Molecular weight:  201.23
    Synonyms:  3-benzyl-3-aza-bicyclo[3.1.0]hexane-2,4-dione | 3-benzyl-3-azabicyclo[3.1.0]hexane-2,4-dione | JEISW...
    SMILES:  C1C2C1C(=O)N(C2=O)CC3=CC=CC=C3
    InChIKey:  JEISWFNRNZRSHM-UHFFFAOYSA-N
    InChI:  InChI=1S/C12H11NO2/c14-11-9-6-10(9)12(15)13(11)7-8-4-2-1-3-5-8/h1-5,9-10H,6-7H2
  5. Phrixotoxin-2
    Cas Number:  221889-63-0
    Formula:  C169H259N49O43S8
    Molecular weight:  3923
    Synonyms:  YCQKWMWTCDEERKCCEGLVCRLWCKRIINM(Modifications:Met-31=C-terminalamide | Disulfidebridges:2-16,9-21and...
  6. rel-(1R,3s,5S,6r)-6-(tert-butoxycarbonylamino)bicyclo[3.1.0]hexane-3-carboxylic acid
    Cas Number:  2905463-63-8
    SMILES:  CC(C)(C)OC(=O)N[C@@H]1[C@H]2C[C@H](C(=O)O)C[C@H]21
  7. 4-Chloro-7-fluoro-2，3-dihydro-1H-inden-1-one
    Cas Number:  1260018-63-0
    Formula:  C9H6ClFO
    Molecular weight:  184.59
    SMILES:  C1CC(=O)C2=C(C=CC(=C21)Cl)F
    InChIKey:  GOQJQZXYADJAQA-UHFFFAOYSA-N
    InChI:  InChI=1S/C9H6ClFO/c10-6-2-3-7(11)9-5(6)1-4-8(9)12/h2-3H,1,4H2
  8. Filapixant
    Cas Number:  1948232-63-0
    Formula:  C24H26F3N5O3S
    Molecular weight:  521.56
    SMILES:  CC1=CN=C(S1)C2=CC(=CC(=C2)OC[C@H]3CN(CCO3)C)C(=O)N[C@H](C)C4=CN=C(N=C4)C(F)(F)F
  9. Myristic acid
    114 Citations
    Cas Number:  544-63-8       EC Number: 208-875-2
    Formula:  C14H28O2
    Molecular weight:  228.37
    Synonyms:  NSC 5028 | Tetradecanoic acid | C14:0 | 1-Tridecanecarboxylic acid
    SMILES:  CCCCCCCCCCCCCC(=O)O
    InChIKey:  TUNFSRHWOTWDNC-UHFFFAOYSA-N
    InChI:  InChI=1S/C14H28O2/c1-2-3-4-5-6-7-8-9-10-11-12-13-14(15)16/h2-13H2,1H3,(H,15,16)
  10. Titanium tetrafluoride
    10 Citations
    Cas Number:  7783-63-3
    Formula:  F4Ti
    Molecular weight:  123.86
    Synonyms:  EINECS 257-011-0 | A840304 | MFCD00042545 | UNII-T08RW8YRG1 | Q126258 | EINECS 232-017-6 | BCP28986 ...
    SMILES:  F[Ti](F)(F)F
    InChIKey:  XROWMBWRMNHXMF-UHFFFAOYSA-J
    InChI:  InChI=1S/4FH.Ti/h4*1H;/q;;;;+4/p-4
  11. 2-Methyl-1-(naphthalen-2-yl)propan-2-amine
    Cas Number:  198226-63-0
    Formula:  C14H17N
    Molecular weight:  199.29
    Synonyms:  alpha,alpha-Dimethyl-2-Naphthaleneethanamine
    SMILES:  CC(C)(CC1=CC2=CC=CC=C2C=C1)N
    InChIKey:  MUSKTCTZFQZRIL-UHFFFAOYSA-N
    InChI:  InChI=1S/C14H17N/c1-14(2,15)10-11-7-8-12-5-3-4-6-13(12)9-11/h3-9H,10,15H2,1-2H3
  12. , Glutamate [NMDA] receptor antagonist
    Perzinfotel, Glutamate [NMDA] receptor antagonist
    Cas Number:  144912-63-0(DMSO)
    Formula:  C9H13N2O5P
    Molecular weight:  260.18
    SMILES:  C1CNC2=C(C(=O)C2=O)N(C1)CCP(=O)(O)O
  13. JPM-OEt
    Cas Number:  262381-84-0
    Formula:  C20H28N2O6
    Molecular weight:  392.45
    SMILES:  O=C([C@H]1O[C@@H]1C(N[C@H](C(NCCC2=CC=C(O)C=C2)=O)CC(C)C)=O)OCC
  14. 3-hydroxycyclopentan-1-one
    Cas Number:  26831-63-0
    Formula:  C5H8O2
    Molecular weight:  100.117
    SMILES:  C1CC(=O)CC1O
    InChIKey:  GULNLSGTYCQLLM-UHFFFAOYSA-N
    InChI:  InChI=1S/C5H8O2/c6-4-1-2-5(7)3-4/h4,6H,1-3H2
  15. NPE-caged-proton
    Cas Number:  1186195-63-0
    Formula:  C8H8NNaO6S
    Molecular weight:  269.21
    Synonyms:  NPE-caged-sulfate | 1-(2-Nitrophenyl)ethyl sulfate sodium salt
    SMILES:  CC(C1=CC=CC=C1[N+](=O)[O-])OS(=O)(=O)[O-].[Na+]
    InChIKey:  LCCXAXUWDTVOHF-UHFFFAOYSA-M
    InChI:  InChI=1S/C8H9NO6S.Na/c1-6(15-16(12,13)14)7-4-2-3-5-8(7)9(10)11;/h2-6H,1H3,(H,12,13,14);/q;+1/p-1
  16. (3R)-N-methyloxolan-3-amine hydrochloride
    Cas Number:  1292324-63-0       EC Number: 823-929-0
    Synonyms:  AS-79223 | MFCD11042650 | (3R)-N-METHYLOXOLAN-3-AMINE HCL | (3R)-N-methyloxolan-3-amine;hydrochlorid...
    SMILES:  CNC1CCOC1.Cl
    InChIKey:  FHFUVNKNOZMSJF-NUBCRITNSA-N
    InChI:  InChI=1S/C5H11NO.ClH/c1-6-5-2-3-7-4-5;/h5-6H,2-4H2,1H3;1H/t5-;/m1./s1
  17. Methyl 3-nitro-5-(trifluoromethyl)benzoate
    Cas Number:  22227-63-0
    SMILES:  COC(=O)C1=CC(=CC(=C1)[N+](=O)[O-])C(F)(F)F
    InChIKey:  GMGZRXWZOZSBED-UHFFFAOYSA-N
    InChI:  InChI=1S/C9H6F3NO4/c1-17-8(14)5-2-6(9(10,11)12)4-7(3-5)13(15)16/h2-4H,1H3
  18. Terbium fluoride
    5 Citations
    Cas Number:  13708-63-9       EC Number: 237-247-0
    Formula:  TbF3
    Molecular weight:  215.92
    Synonyms:  Terbium trifluoride | Terbium( cento) fluoride | Terbium fluoride | DTXSID8065589 | MFCD00049572 | T...
    SMILES:  F[Tb](F)F
    InChIKey:  LKNRQYTYDPPUOX-UHFFFAOYSA-K
    InChI:  InChI=1S/3FH.Tb/h3*1H;/q;;;+3/p-3
  19. CYM 50769
    Cas Number:  1421365-63-0
    Formula:  C24H17ClN2O3
    Molecular weight:  416.86
    Synonyms:  CYM50769 | CYM-50769 | 5-Chloro-2-(9H-fluoren-9-yl)-4-(4-methoxyphenoxy)-3(2H)-pyridazinone | 5-chlo...
    SMILES:  COC1=CC=C(C=C1)OC2=C(C=NN(C2=O)C3C4=CC=CC=C4C5=CC=CC=C35)Cl
    InChIKey:  QHVSQUYCVUHYKT-UHFFFAOYSA-N
    InChI:  InChI=1S/C24H17ClN2O3/c1-29-15-10-12-16(13-11-15)30-23-21(25)14-26-27(24(23)28)22-19-8-4-2-6-17(19)18-7-3-5-9-20(18)22/h2-14,22H,1H3
  20. N,N'-Dioctadecyl-3,4,9,10-perylenedicarboximide
    Cas Number:  25834-02-0
    Formula:  C60H82N2O4
    Synonyms:  25834-02-0|N,N'-Dioctadecyl-3,4,9,10-perylenedicarboximide|SCHEMBL6263953|DTXSID301129430|N,N invert...
    SMILES:  CCCCCCCCCCCCCCCCCCN1C(=O)C2=C3C(=CC=C4C3=C(C=C2)C5=C6C4=CC=C7C6=C(C=C5)C(=O)N(C7=O)CCCCCCCCCCCCCCCCCC)C1=O
    InChIKey:  SPPVDEHBIATCNG-UHFFFAOYSA-N
    InChI:  InChI=1S/C60H82N2O4/c1-3-5-7-9-11-13-15-17-19-21-23-25-27-29-31-33-43-61-57(63)49-39-35-45-47-37-41-51-56-52(42-38-48(54(47)56)46-36-40-50(58(61)64)55(49)53(45)46)60(66)62(59(51)65)44-34-32-30-28-26-2See more
  21. cis-Bicyclo[3.3.0]octane-3,7-dione
    1 Citations
    Cas Number:  51716-63-3
    Formula:  C8H10O2
    Molecular weight:  138.16
    Synonyms:  2,5(1H,3H)-Pentalenedione, tetrahydro- | 2,5(1H,3H)-Pentalenedione, tetrahydro-, cis- | cis-Tetrahyd...
    SMILES:  C1C2CC(=O)CC2CC1=O
    InChIKey:  HAFQHNGZPQYKFF-UHFFFAOYSA-N
    InChI:  InChI=1S/C8H10O2/c9-7-1-5-2-8(10)4-6(5)3-7/h5-6H,1-4H2
  22. 2-amino-4,6-dichlorobenzoic acid
    Cas Number:  20776-63-0
    Formula:  C7H5Cl2NO2
    Molecular weight:  206.03
    SMILES:  C1=C(C=C(C(=C1N)C(=O)O)Cl)Cl
    InChIKey:  VNOYJBSEORILIE-UHFFFAOYSA-N
    InChI:  InChI=1S/C7H5Cl2NO2/c8-3-1-4(9)6(7(11)12)5(10)2-3/h1-2H,10H2,(H,11,12)
  23. 3-Fluoro-5-((trimethylsilyl)ethynyl)-picolinonitrile
    Cas Number:  1246088-63-0
    Formula:  C11H11FN2Si
    Molecular weight:  218.3
    SMILES:  C[Si](C)(C)C#CC1=CC(=C(N=C1)C#N)F
    InChIKey:  LLWNCDQABKNLAA-UHFFFAOYSA-N
    InChI:  InChI=1S/C11H11FN2Si/c1-15(2,3)5-4-9-6-10(12)11(7-13)14-8-9/h6,8H,1-3H3
Page
per page
Shop By
Filters
Molecule Type
  1. Small molecule 144 items
  2. Protein 24 items
  3. Unknown 22 items
  4. Oligosaccharide 4 items
  5. 聚合物 3 items
  6. Antibody 1 item
Target
  1. FAAH 3 items
  2. RPS6KB1 3 items
  3. AR 3 items
  4. TLR7 3 items
  5. ESR1 2 items
  6. IGF1R 2 items
  7. SLC9A3 2 items
  8. PGR 2 items
  9. MAPK10 2 items
  10. MAPK8 2 items
  11. MAP3K13 2 items
  12. MAP3K12 2 items
  13. BIRC2 2 items
  14. BIRC3 2 items
  15. BACE1 2 items
  16. BACE2 2 items
  17. XIAP 2 items
  18. XBP1 2 items
  19. CHRNA3 2 items
  20. EDNRA 2 items
  21. FOLH1 2 items
  22. KCNH2 2 items
  23. GLP1R 2 items
  24. OPRD1 2 items
  25. OPRK1 2 items
  26. OPRL1 2 items
  27. OPRM1 2 items
  28. MAP3K9 2 items
  29. MTOR 2 items
  30. CYP1A2 1 item
  31. CYP2D6 1 item
  32. CXCR4 1 item
  33. CYP3A4 1 item
  34. GIPR 1 item
  35. ENPP2 1 item
  36. CRHR2 1 item
  37. CSF1R 1 item
  38. CSNK2A2 1 item
  39. BRD4 1 item
  40. CCKAR 1 item
  41. CDK17 1 item
  42. CRHR1 1 item
  43. EDN2 1 item
  44. ROCK2 1 item
  45. ROCK1 1 item
  46. STK26 1 item
  47. FFAR4 1 item
  48. FECH 1 item
  49. FLT3 1 item
  50. FSHR 1 item
  51. CCKBR 1 item
  52. TAS2R7 1 item
  53. TTK 1 item
  54. PLK4 1 item
  55. PIK3CG 1 item
  56. PIK3CA 1 item
  57. PIK3CB 1 item
  58. PIK3CD 1 item
  59. PDE10A 1 item
  60. PKN2 1 item
  61. TACR3 1 item
  62. PRKCZ 1 item
  63. PRKCD 1 item
  64. JAK1 1 item
  65. BMP2K 1 item
  66. BRD3 1 item
  67. BRD2 1 item
  68. NPR3 1 item
  69. BDKRB2 1 item
  70. AURKA 1 item
  71. AURKB 1 item
  72. 1 item
  73. CHRNA5 1 item
  74. AAK1 1 item
  75. ACAD10 1 item
  76. APLNR 1 item
  77. GRIA4 1 item
  78. GRIK1 1 item
  79. GSK3B 1 item
  80. GRIA2 1 item
  81. GRIA3 1 item
  82. GSK3A 1 item
  83. SLC2A1 1 item
  84. GCGR 1 item
  85. GRIA1 1 item
  86. GNRHR 1 item
  87. IDH1 1 item
  88. NUAK2 1 item
  89. NTRK2 1 item
  90. NPY5R 1 item
  91. NQO2 1 item
  92. NTRK1 1 item
  93. NTRK3 1 item
  94. TACR1 1 item
  95. NPY4R 1 item
  96. NPY1R 1 item
  97. IL12B 1 item
  98. IL23A 1 item
  99. IDO1 1 item
  100. JAK2 1 item
  101. NPY2R 1 item
Antibody Type
  1. Primary antibody 1 item
Application
  1. Functional Studies 2 items
  2. SDS-PAGE 2 items
  3. Animal Model 1 item
  4. Cell Culture 1 item
  5. ELISA 1 item
  6. Flow Cytometry 1 item
  7. Functional Assay 1 item
Host species
  1. Human 1 item
Clonality
  1. Recombinant 1 item
Species
  1. Human 2 items
Active
  1. Bioactivity 2 items
Animal free
  1. Yes 2 items
Carrier free
  1. Yes 2 items
Physical Form
  1. Solid 28 items
  2. Liquid 7 items
  3. Lyophilized 2 items
  4. Powder 2 items
Purity
  1. ≥98% 124 items
  2. ≥97% 70 items
  3. ≥99% 58 items
  4. ≥95% 47 items
  5. ≥98%(HPLC) 16 items
  6. ≥97%(HPLC) 11 items
  7. ≥95%(HPLC) 10 items
  8. ≥96% 9 items
  9. ≥99%(HPLC) 7 items
  10. ≥90% 4 items
  11. ≥98%(GC) 4 items
  12. ≥99%(GC) 4 items
  13. ≥80% 3 items
  14. ≥99.5% 3 items
  15. ≥99.9% 3 items
  16. ≥90%(HPLC) 2 items
  17. ≥94% 2 items
  18. ≥96%(HPLC) 2 items
  19. ≥97%(GC) 2 items
  20. ≥98%(mixture of isomers) 2 items
  21. ≥99.8% 2 items
  22. ≥99.9% metals basis 2 items
  23. ≥99.9%(GC) 2 items
  24. ≥99.99% metals basis 2 items
  25. ≥99.999% metals basis 2 items
  26. ≥85%(HPLC) 1 item
  27. ≥90% cyclodextrin basis(HPLC) 1 item
  28. ≥90%(SDS-PAGE) 1 item
  29. ≥92%(HPLC) 1 item
  30. ≥95%(SDS-PAGE&SEC-HPLC) 1 item
  31. ≥97%(T) 1 item
  32. ≥98%(CP),≥98 atom% D 1 item
  33. ≥98%,≥99%(ee) 1 item
  34. ≥99 atom% D,≥98% 1 item
  35. ≥99% metals basis 1 item
  36. ≥99%(SEC-HPLC) 1 item
  37. ≥99.5%(GC) 1 item
  38. ≥99.7% 1 item
  39. ≥99.95% metals basis 1 item
  40. ≥99.995% metals basis 1 item
Protein length
  1. Protein fragment 1 item
Source
  1. Recombinant 2 items
  2. CHO supernatant 1 item
Grade
  1. Moligand™ 54 items
  2. analytical standard 7 items
  3. ACS 6 items
  4. BioReagent 6 items
  5. for cell culture 6 items
  6. AR 4 items
  7. PrimorTrace™ 4 items
  8. sublimed grade 4 items
  9. anhydrous 3 items
  10. Animal Free 3 items
  11. Carrier Free 3 items
  12. Reagent Grade 3 items
  13. γ-irradiated 3 items
  14. ActiBioPure™ 2 items
  15. Bioactive 2 items
  16. for molecular biology 2 items
  17. GMP 2 items
  18. High Performance 2 items
  19. Ph.Eur. 2 items
  20. PharmPure™ 2 items
  21. Premium pure 2 items
  22. Suitable for Analysis 2 items
  23. Azide Free 1 item
  24. Chromatographic grade 1 item
  25. Chromatography Plus Grade 1 item
  26. ExactAb™ 1 item
  27. for DNA synthesis 1 item
  28. for HPLC 1 item
  29. for insect cell culture 1 item
  30. for plant cell culture 1 item
  31. for preparative chromatography 1 item
  32. Low Endotoxin 1 item
  33. pesticide residue grade 1 item
  34. pharmaceutical grade 1 item
  35. PureSpectra™ 1 item
  36. Recombinant 1 item
  37. Spectrum pure 1 item
  38. Standard for GC 1 item
  39. technical grade 1 item
  40. Ultra dry 1 item
  41. UltraPureChrom™ 1 item
  42. USP 1 item
  43. Validated 1 item
Action Type
  1. INHIBITOR 23 items
  2. AGONIST 20 items
  3. ANTAGONIST 12 items
  4. SEQUESTERING AGENT 1 item
Compare Products
  1. Remove This Item
Compare
Clear All
You have no items to compare.
My Wish Lists
Last Added Items
    1. Add to Cart
      Remove This Item
    Go to Wish List
    You have no items in your wish list.

    Shall we send you a message when we have discounts available?

    Remind me later

    Thank you! Please check your email inbox to confirm.

    Oops! Notifications are disabled.

    Privacy Policy Website Terms of Use Return policy Terms and Conditions of Sale Cookie Policy Sales Policy
    Products are chemical reagents for research use only and are not intended for human use. We do not sell to patients.
    Copyright © 2023-present Aladdin Scientific Corp . All rights reserved.