This is a demo store. No orders will be fulfilled.

Bay 55-9837 TFA , Agonist of PAC 1 receptor;Agonist of VPAC 1 receptor;Agonist of VPAC 2 receptor, CAS No.463930-25-8, Agonist of PAC 1 receptor;Agonist of VPAC 1 receptor;Agonist of VPAC 2 receptor

In stock
Item Number
B288002
Grouped product items
SKU Size
Availability
Price Qty
B288002-1mg
1mg
3
$345.90
B288002-5mg
5mg
2
$1,179.90
B288002-10mg
10mg
1
$1,499.90

Potent and selective VPAC2agonist

Basic Description

Product Name Bay 55-9837 TFA , Agonist of PAC 1 receptor;Agonist of VPAC 1 receptor;Agonist of VPAC 2 receptor, CAS No.463930-25-8
Synonyms UNII-SQD60KZ8RJ | His-ser-asp-ala-val-phe-thr-asp-asn-tyr-thr-arg-leu-arg-lys-gln-val-ala-ala-lys-lys-tyr-leu-gln-ser-ile-lys-asp-lys-arg-tyr-NH2 | BAY-55-9837 | AKOS024457254 | SQD60KZ8RJ | PD079349
Grade Moligand™
Product Description

Bay 55-9837 TFA is a potent and highly selective agonist of VPAC2. Bay 55-9837 TFA may be a useful therapy for the research of type 2 diabetes.

Specifications & Purity Moligand™, ≥98%
Biochemical and Physiological Mechanisms Selective VPAC2receptor agonist (EC50values are 0.4, 100 and >1000 nM for VPAC2, VPAC1and PAC1, respectively in a cAMP accumulation assay; IC50values are 60, 8700 and >10000 nM for VPAC2, VPAC1and PAC1, respectively in a competition binding assay). Stimul
Sequence HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY(Modifications: Tyr-31 = C-terminal amide)
Action Type AGONIST
Mechanism of action Agonist of PAC 1 receptor;Agonist of VPAC 1 receptor;Agonist of VPAC 2 receptor

Associated Targets(Human)

VIPR2 Tchem Vasoactive intestinal polypeptide receptor 2 (0 Activities)
Activity Type Activity Value -log(M) Mechanism of Action Activity Reference Publications (PubMed IDs)
VIPR1 Tchem Vasoactive intestinal polypeptide receptor 1 (0 Activities)
Activity Type Activity Value -log(M) Mechanism of Action Activity Reference Publications (PubMed IDs)
ADCYAP1R1 Tchem Pituitary adenylate cyclase-activating polypeptide type I receptor (0 Activities)
Activity Type Activity Value -log(M) Mechanism of Action Activity Reference Publications (PubMed IDs)

Storage and Shipping

Storage Temp Store at -20°C
Shipped In Ice chest + Ice pads
CAS 463930-25-8

Certificates(CoA,COO,BSE/TSE and Analysis Chart)

C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot Number Certificate Type Date Item
C2408276 Certificate of Analysis Jan 23, 2024 B288002
C2408277 Certificate of Analysis Jan 23, 2024 B288002
C2408278 Certificate of Analysis Jan 23, 2024 B288002
C2408279 Certificate of Analysis Jan 23, 2024 B288002
C2408286 Certificate of Analysis Jan 23, 2024 B288002
C2408287 Certificate of Analysis Jan 23, 2024 B288002

Genetic information

Alternate Names UNII-SQD60KZ8RJ | His-ser-asp-ala-val-phe-thr-asp-asn-tyr-thr-arg-leu-arg-lys-gln-val-ala-ala-lys-lys-tyr-leu-gln-ser-ile-lys-asp-lys-arg-tyr-NH2 | BAY-55-9837 | AKOS024457254 | SQD60KZ8RJ | PD079349
Reference
  • 1. Kinetics and inhibition of recombinant human cystathionine gamma-lyase. Toward the rational control of transsulfuration., The Journal of biological chemistry, Steegborn, C C and 7 more authors.
  • 2. Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences., Proceedings of the National Academy of Sciences of the United States of America, Strausberg, Robert L RL and 83 more authors.
  • 3. Genomic basis of cystathioninuria (MIM 219500) revealed by multiple mutations in cystathionine gamma-lyase (CTH)., Human genetics, Wang, Jian J and Hegele, Robert A RA.
  • 4. Cloning and nucleotide sequence of human liver cDNA encoding for cystathionine gamma-lyase., Biochemical and biophysical research communications, Lu, Y Y, O'Dowd, B F BF, Orrego, H H and Israel, Y Y.
  • 5. Single nucleotide polymorphism in CTH associated with variation in plasma homocysteine concentration., Clinical genetics, Wang, J J, Huff, A M AM, Spence, J D JD and Hegele, R A RA.
  • 6. Cystathionine gamma-lyase overexpression inhibits cell proliferation via a H2S-dependent modulation of ERK1/2 phosphorylation and p21Cip/WAK-1., The Journal of biological chemistry, Yang, Guangdong G, Cao, Kun K, Wu, Lingyun L and Wang, Rui R.
  • 7. The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)., Genome research, Gerhard, Daniela S DS and 115 more authors.
  • 8. Towards a proteome-scale map of the human protein-protein interaction network., Nature, Rual, Jean-François JF and 37 more authors.
  • 9. The DNA sequence and biological annotation of human chromosome 1., Nature, Gregory, S G SG and 178 more authors.
  • 10. Polymorphisms in one-carbon metabolism and trans-sulfuration pathway genes and susceptibility to bladder cancer., International journal of cancer, Moore, Lee E LE and 14 more authors. more

Solution Calculators

Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.